SpectraMax ABS Plus reader utilizes Molecular Devices PathCheck Sensor- the only patented technology. 305 reference level saturation. SpectraMax i3x Injector Cartridge with SmartInject® Technology. SpectraMax® Quant™ dsDNA Assay Kits The SpectraMax® Quant™ dsDNA Assay Kits are designed for fluorescence-based dsDNA quantitation across a broad range of concentrations. The SPECTRAmax™ PLUS microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentrations. 0 nm increments Wavelength Bandwidth: 2 nm Wavelength Accuracy: < ± 2. A microplate reader as The SpectraMax® i3x Multi-Mode Microplate Reader measures absorbance, fluorescence, and luminescence with available upgrades including western blot, cell imaging, and fast kinetics with injectors plus additional detection modes. Fixed a problem where Column Priority rather than AutoRead was available in the SpectraMax 384 instrument setup. Contains one microplate adapter, five 24-well low volume slides, five 64-well low volume bottom slides, and five of each cover slide (2 µL and 4 µL) 0200-6267. Industry-leading SoftMax® Pro Microplate Data Acquisition and Analysis Software eliminates the need to export dataThe SpectraMax ABS Plus, can accommodate standard 96-well plates and 384-well plates. 4 µL DNA standards. 5014038F 3 Contents SafetyInformation 5 Warnings,Cautions,Notes,andTips 5 Chapter1:Introduction 11 ComputerIntegration 11 Applications 12 DualPhotomultiplierTubes 12For SpectraMax iD5, i3x, and Mini readers, the read height setting should be optimized for the microplate used. With optimized reagents and the industry-leading data acquisition and analysis tool SoftMax® Pro 7 Software, the SpectraMax iD3 allows you to customize your workflow to. The microplates were read the next day from the bottom and the top in SpectraMax M5 and Gemini EM readers. SpectraMax M3, M4, M5, and M5e Microplate Reader User Guide Plate Adapter Before you read standard 96-well or 384-well plates from the top, you must insert the plate adapter in the plate drawer. The SpectraMax M5e Reader offers the additional benefit of being certified for Cisbio Bioassays’ HTRF® Assays. There should be a value for 900 and 1000. Fluorescence Microplate Reader Comparison Chart. The SpectraMax® ABS Plus Microplate Reader can run . Lids for a case of 200 microplates must be purchased separately. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. For fluorescence intensity assays, users can select from top- or bottom-read modes for improved sensitivity in solution and cell. Ensure there are three inches between the back of the instrument and any other objects or surfaces so it has proper air flow. SoftMax® Pro Software is included and enables data visualized in 3D plots, gray scale, kinetic curve. The SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). 313 reference gain check fail. Read one sample or up to 384 in a single plate read using any standard. 012 fmol 0. Fluorescent detection is achieved from the top, through the entire depth of sample in the microplate well. to 11. For more sample throughput, both readers can be easily SpectraMax i3x Microplate Reader, Molecular Devices (Cat# i3X) 96-well white walled clear bottom plates, Costar (Cat# 3903) Purified luciferase, Promega (Cat# E1701) 384-well solid white plates, Greiner (Cat# 655075) CHO-K1 cells, ATCC (Cat# CCL-61) Complete Growth Media Ham’s F12 Medium, Life Technologies (Cat# 11765-54) SpectraMaxPlus384reads96-wellplates,384-wellplates,andcuvettes. 7 are achievable. <p>384-well transparent tissue-culture treated (TC-treated) microplate for cell-based absorbance (colorimetric) assays. DNA provides the same sensitivity as a spectrophotometer. Categories:. , FI 45 sec. com. Now you can run both standard spectrophotometer and microplate reader applications on the same instrument. 1) All parts of the SPECTRAmax PLUS 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. 25 µL/well in a 384-well plate, using AlphaScreen Phosphotyrosine (PT66) Assay Kit 0200-7017. 专为科研检测平台量身打造的灵活且强大的小型微孔板读板机（酶标仪），具备终点法和动力学检测模式，标准配置6块滤光片，覆盖蛋白定量、细胞活力、农药残留、ELISA实验等. To prevent such interference, select the Interlaced Reading option to read every other well in a checkerboard pattern in the first run and then read the previously omitted wells in a second run. Multimode Reader Comparison Chart. SpectraMax™ Plus 384 VersaMax™The SpectraMax M2e is a dual-monochromator, multi-detection microplate reader with a dual-mode cuvette port and 96 or 384 microplate reading capability. selected when SpectraMax Plus 384 was selected in the Preferences dialog. ® reader to the computer. SpectraMax 340PC384: SpectraMax Plus384: VERSAmax: Vmax: Tecan: Sunrise: Trinean: DropSense96: AMBIENT TEMPERATURE STORAGE: Liconic: LPX 220 Hotel: LPX 440 Hotel:. The SpectraMax® Gemini™ XPS Microplate Spectrofluorometer from Molecular Devices® provides a flexible environment. 8 (W) x 15 (D)SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. SpectraMax® 340PC384 microplate reader provides everything needed to measure absorbance in the visible range, including temperature control, a robotics-compatible interface and SoftMax® Pro data analysis software. These models can no longer be repaired. Molecular Devices SpectraMax ® Quant family of dsDNA quantitation kits allows for very accurate quantitation of dsDNA in a linear range from 0. For more information, please visit us at 384 Plus UV/Vis Microplate Reader, Molecular Devices. 0nm increments. The AlphaScreen Detection Cartridges utilize a 680nm Laser Diode to provide a sensitive reading system for AlphaScreen assays. SpectraMax i3x Multi-Mode Microplate Reader. The narrow bandwidths used by the model increase measurement accuracy and linearity over a wide. Top detection is available for fluorescence detection on the SpectraMax M2, while top and bottom reads are possible on the SpectraMax M2 e. The SpectraMax i3x reader measures spectral-based absorbance, fluorescence, and luminescence with the added functionality of modular upgrades for western blot, imaging, and fast kinetics with injectors. Optimized for 96- and 384-well plates, the Multi-Mode Detection Cartridge provides a broad array of measurement capabilities: Fluorescence Intensity (FI), Time. Page 8: Components (enunciator blinks if not at set point). SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. 2 only) SpectraMax M-series Microplate readers. Detection modalities are shown in Table 1-1. 5065390D 3 Contents SafetyInformation 4 Warnings,Cautions,Notes,andTips 4 Chapter1:Introduction 7 ComputerIntegration 8 PlateControls 9 CuvetteChamber 10Multimode Reader Comparison Chart. 5 mP 3 mP 1536-well (8 µL) 1. microplates or in a cuvette at a selected. For the SpectraMax Plus 384 you can do fixed point cuvette reads. Molecular Devices SpectraMax 384 Plus Microplate Reader Specifications. Every SpectraMax® 340 PC 384 microplate reader has an optical system built around a monochromator. com Check our website for a current listing of worldwide distributors. 1. Published Dec 16, 2020 | Updated Dec 16, 2020. This user guide provides detailed instructions on how to set up, run, and analyze the validation tests, as well as how to troubleshoot common issues. 1) All parts of the SPECTRAmax PLUS 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. The SpectraMax L is a dedicated luminescence microplate reader offering outstanding sensitivity, flexibility, automation capability, and validation tools. The SpectraMax® iD3 Multi-Mode Microplate Reader is the cornerstone of a complete laboratory solution to help you expand the boundaries of your research capabilities. The EMax® Plus Microplate Reader is designed to be a versatile and robust plate reader for research laboratories. Molecular Devices recommends that you use high-quality, doubleshielded cables to connect your SpectraMax. both cuvette-based and microplate reader applications on the same instrument. For very concentrated samples, use a minimumThe ProcartaPlex 384-well format was specifically developed to increase sample throughput while maintaining the robustness of a 96-well assay. Using the patented PathCheck® Pathlength Measurement Technology, the SpectraMax M4 Microplate Reader transforms each well in a microplate to a fixed. High-precision 9 channel system; filter-less with up to 6 wavelengths. Molecular Devices SpectraMax 384 Plus Microplate Reader. The SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. Light Source: Xenon flash lamp. SpectraMax® Gemini™ EM Microplate Reader, Molecular Devices. 304 signal level saturation. no. Features demonstrated by the model include temperature control, a robot-compatible interface and data analysis software. In addition, the iD5 reader measures TRF and FP and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter assays with injectors, and western blot detection. The 1/absorptivity value for double stranded DNA at 260 nm is commonly assumed. SpectraMax® 340PC384 Microplate Reader for acquiring data in endpoint, kinetic, and spectral scan modes using wavelegths from 340-850 nm, tunable in 1 nm increments. Simplified microplate washing from single-tube dispensing to washing full 96- and 384-well plates. Multimode Readers Comparison Chart. For. . SpectraMax® i3 Multi-ModeDetectionPlatform withtheSpectraMax® MiniMax™ImagingCytometer UserGuide 5025027A April2013. The technology allows automatic adjustment of good absorbance to a tube equivalent path length of 1 cm, converted to 96 or 384 tubes. Minimum volume and maximum throughput with 96- or 384. The SpectraMax L reader is upgradeable to dual-channel configurations for a 2-fold increase in throughput for medium throughput and secondary screening laboratories. Details. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselected wavelengthsinasinglereadmode. Now you can run both standard spectrophotometer and microplate reader applications on the same instrument. Labsystems Nepheloskan Ascent Microplate Reader. Normally this fluorometric assay is performed in 96-well microplates. The SpectraTest® Validation Plates are valuable tools for verifying that absorbance-, fluorescence-, and luminescence-capable microplate readers are operating correctly for GMP and GLP laboratories. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. Which SpectraMax Multi-Mode Microplate Reader do you need? Detection Modes Absorbance Fluorescence Intensity Luminescence Time-Resolved Fluorescence Fluorescence Polarization HTRF Upgrade Options Plate Formats 6-, 12-, 24-, 48-, 96-, 384-Well Microplates Certification and Validation IMAP Validation (TR-FRET only) (TR-FRET. With optimized reagents, option to operate the. The plate reader optics are tunable for absorbance, fluorescence intensity, fluorescence polarization, and time resolved fluorescence assays (TRF). Biocompare is the leading. SpectraMaxPlus384reads96-wellplates,384-wellplates,andcuvettes. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselectedwavelengthsina singlereadmode. 314 low lamp level warning. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). The light transmittance was evaluated as function of wavelength of the BNC membranes. Detection Cartridge (384) (PN 0200-7015) • SpectraMax Paradigm Glow Luminescence (LUM) Detection Cartridge (96) (PN 0200-7014) A glow luminescence detection cartridge contains the optics and electrical components needed to perform specific measurement modes or for specific applications. Wavelength range: Excitation: 250-850 nm, Emission: 360-850 nm. Browse for different fluorescent readers below and compare across different instrument suppliers. Special tubing set, Multidrop (length of tubing 50 - 200 cm in 10 cm increments) The minimum order for this item is . Keywords spectramax i3 multi-mode platform, spectramax i3, spectramax i3 system, scanlater western blot system, spectramax minimax imaging cytometer, softmax pro software, metamorph software. This kit is optimized for Molecular Devices384 wells, the SpectraMax iD3 reader is the complete solution for all your research needs. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Spectramax i3 manual. ester flash assays, in both 96- and 384-well plates. The narrow bandwidths used by the model increase measurement accuracy and linearity over a wide range. The 190 can read across the entirety of the UV-Vis. Features. Microplate Spectrophotometer. Manufacturer: Molecular Devices; Model: SpectraMax; Will included PC workstation w/ preloaded softmax pro software Wavelength Range: 340 – 850 nm Wavelength Selection: Monochromator, tunable 1. Read one sample or up to 384 in a single plate. TheSpectraMax®Plus384addstheabilitytoreadcuvettes. The SpectraMax® M5 Multi-Mode Microplate Reader delivers single mode reader performance and can be equipped to read volumes as low as 2uL in one multimode reader package. Shaking capabilities. As a generous estimate, you might consider 300 W (at 120 Volts) per Spectramax reader, plus another 300 W for the Computer. 0200-6263. For more sample throughput, the system canThis version is compatible with the following instruments: SpectraMax® Mini Multi-Mode Microplate Reader (software version 7. The PA 800 Plus system is a robust analytical, kit-based platform that can help you with: Purity/Heterogeneity with gold standard CE-SDS in minutes. The Spectramax 384Plus is a microplate spectrofluorometer from Molecular Devices. 96-well Half Area 384- Low Volume 1536- Microplate Material 96-well Stripwell 96-well well 384-well well Clear polystyrene n n n n Solid black or white polystyrene n n n n n n Clear bottom black or white polystyrene n n n n n Polypropylene n n n Solid black or white polypropylene n n*SpectraMax Paradigm Multi-Mode Detection Platform User Guide Loading and Unloading Microplates To load or unload a microplate: 1. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Temperature control and shaking come standard. Light Source: Xenon flash. The SpectraMax® iD5 Multi-Mode Microplate Reader is the complete laboratory solution to help you increase your research capabilities and comes with built-in. 96, 384 wells Light source Xenon flash lamp (1 joule/flash) Detector Photomultiplier tube (PMT) Read time** 96 wells: 384 wells: Abs 18 sec. The Molecular Devices SpectraMax 384 is a UV/Vis spectrophotometer and microplate reader combination for more reliable and fast data reporting with built-in cuvette port and. SoftMax Pro Software, the industry-leading microplate reader software for the SpectraMax Plus 384 system, allows complete customization of data collection and. Contact Information: Craig Adams. Detection cartridge modularity allows for easy addition of new read modes within minutes without. QuickSync. The SpectraMax® absorbance spectrophotometers and plate readers provide the versatility and convenience for a wide range of assays such as ELISAs, nucleic acid and protein quantitation, and microbial growth. By using PathCheck, SpectraMax readers can automatically normalize sample absorbance values to a 1-cm pathlength and calculate the concentrations. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. Used MOLECULAR DEVICES SPECTRAmax 384 Spectrophotometer For Sale - DOTmed Listing #2356563: Spectra Max Plus 384 Microplate Spectrophotometer - GOOD WORKING UNIT Equipment was recently removed. Each SpectraMax® 340 PC 384 Microplate Reader has an. AlphaScreen assays cannot be done on the SpectraMax M series, Gemini, and SpectraMax iDx (iD3/iD5) readers. SpectraMax M2, M2e; SpectraMax M3, M4, M5, M5e; FilterMax™ Multi-Mode Detection Platform. Biocompare is the leading resource for up-to-date product information, product reviews, and new technologies for life scientists. The SpectraMax ABS Plus Microplate Reader can run both cuvette-based and microplate based reader applications on the same instrument. For more sample throughput, both readers can be easilySpectraMax i3x Microplate Reader, Molecular Devices (Cat# i3X) 96-well white walled clear bottom plates, Costar (Cat# 3903) Purified luciferase, Promega (Cat# E1701) 384-well solid white plates, Greiner (Cat# 655075) CHO-K1 cells, ATCC (Cat# CCL-61) Complete Growth Media Ham’s F12 Medium, Life Technologies (Cat# 11765-54)SpectraMax190,340PC384,Plus384,VersaMaxMicroplateSpectrophotometersUserGuide 8 0112-0126D ComputerIntegration. Application note showing how SpectraMax® i3x and SpectraMax®iD5 Multi-Mode Microplate Readers are used to performGq-coupled receptor assays using HTRF technology. Reliable performance with a proven track record For nearly 30 years, Molecular Devices has provided scientists with tools to expand the boundaries of their research. SpectraMax ® Plus 384 optics. Compact design. 과 같은 Parameter를 검사하여 평가할 수 있습니다. There were 12 replicate wells per dilution in both 96-well and 384- well plates. 2. A preconfigured protocol with optimized reader settings enabled reading of a 384-well plate in just two minutes. More Product Information. 384 distinct wells in a source plate to a read plate, simultaneously. 00 USDThe SpectraMax® M2 and M2e Systems from Molecular Devices are multi-detection microplate readers with dual-. The Molecular Devices SpectraMax 384 is a UV/Vis spectrophotometer and microplate reader combination for more reliable and fast data reporting with built-in cuvette port and microplate drawer. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). 0. where. 384 wells: Abs 49 sec. Learn how to operate the VersaMax, SpectraMax 340PC384 and SpectraMax 190 Plus384 microplate readers, which offer fast and accurate absorbance measurements for a variety of assays. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. 2) All labor charges to repair the product for a period of one (1) year from the original date of delivery will be paid by Molecular Devices Corporation. The SpectraMax M2e are multidetection microplate readers with dual-monochromators, dual-mode cuvette ports, and top- and bottom-reading capability. Dimensions: 128mm (L) x 86mm (W) x. 96/384-FortheSpectraMax340PC384,presstoselecttoreada96-wellplateora384-wellplate. 4% in white 96- and 384-well microplates Sensitivity (ATP-Glow) Optimized 96 wells 3 pM 384 wells 6 pM. The user must ensure that the meniscus is comfortably above the light beam in standard cuvettes and that the sample chamber in a microcuvette is aligned properly with the beam. Detection of species collected on membrane plates is also possible. SpectraMax Spectrophotometers for UV-Vis Absorbance Detection. The SpectraMax M5e Multi-Mode Microplate Reader features a triple-mode cuvette port, temperature control, microplate shaking, and the industry leading SoftMax Pro. Multimode Readers Comparison Chart. The top- and bottom-reading Gemini EM Microplate Reader with dual monochromators lets users determine the optimal excitation and emission settings for creative new fluorescence. With its dual high-velocity liquid injectors, SpectraMax L can perform both flash and glow luminescence detection applications in 96- and 384-well formats with ease. Molecular Devices SpectraMax Plus 384. 2 5. Analyst, M5, Flex 3, and SpectraMax L readers work differently. Biocompare is the leading resource for up-to. More Product Information. Transcreener® HTS is a universal, high throughput biochemical assay platform based on the detection of nucleotides, which are formed by thousands of cellular enzymes—many of which catalyze the covalent regulatory. Learn how to operate the VersaMax, SpectraMax 340PC384 and SpectraMax 190 Plus384 microplate readers, which offer fast and accurate absorbance measurements for a. The SpectraMax i3x reader has variable bandwidth for fluorescence and luminescence, and you are able to choose either 9nm or 15 nm for excitation and either 15 nm or 25 nm for emission. The SpectraMax® 340PC384 Reader from Molecular Devices provides everything needed to measure absorbance in the visible range, including temperature control, a robotics-compatible interface and SoftMax® Pro Data Acquisition and Analysis Software. The SpectraMax ® Plus 384 Microplate Reader gives you walk-up convenience for both standard spectrophotometer and microplate reader applications on. All have an optical pathlength of 1 cm (10 mm) and standard external dimensions (12. 8 (W) x 15 (D)This SpectraMax Plus 384 Spectrophotometer has been sold, but you can view our other spectrophotometers currently available for purchase here: Plus384, 190, 340PC384, and VersaMax Installation Guide Author: Molecular Devices Subject: Installation Guide Keywords: SpectraMax Versa and others Detection Platform Created Date: 5/17/2023 2:14:27 PMOn SpectraMax L, 1 RLU = 1 count per second for photon counting mode only. 0 OD for earlier models. Reads standard cuvettes & 96-384 well plates from 190 to 1000 nm. Page 14: Component Description† Bottom mounting for SpectraMax Paradigm Readers only. 2. 더 많은. Item SpectraMax 340PC 384 Tunable Spectrophotometer with SoftMax Pro Software; Company Molecular Devices LLC; This product is no longer available on Biocompare. spr SpectraMax iD3 SpectraTest ABS2 v1. Product Specs. Instrument design, user interface capabilities, and cost play key roles in purchasing a suitable microplate reader. The reader adds up to three transfers of assay reagents from a 96- or 384-well source plate to enhance assay design using integrated fluidics. 5 pM 2. Narrow bandwidths deliver increased measurement accuracy and linearity over the widest range of assays, including. Paradigm spectramax manualslibSpectramax id5 Molecular devices spectramax plus 384 user manual pdf downloadShaking spectramax id3 frequently. 5 pM 384-well (50 µL) 6 pM 10 pM 1536-well (8 µL) 19 pM 25 pM 0200-7015 (LUM 384) Optimized Guaranteed* 96-well (200 µL) 1. TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate spectrophotometersproviderapidandsensitivemeasurementsofavarietyofanalytesacross. Page 13: Introduction Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax GEMINI EM. Wavelength Selection. Typical applications for this powerful reader include DNA and RNA quantification. Clamp for injector 1 is on the left and clamp for injector 2 is on the right. SpectraMax ® Plus 384 optics. Molecular Devices Spectramax Plus 384 Microplate Reader is available from The Lab World Group. Item SpectraMax Plus 384 Microplate Spectrophotometer; Company Molecular Devices LLC; Catalog Number SpectraMax Plus 384; This product is no longer available on Biocompare. When reading optical density at wavelengths below 340 nm,. The SpectraMax® 340 PC 384 Absorbance Microplate Reader from Molecular Devices provides the necessary tools for absorbance measurements in the visible range. The SpectraMax® Glo Steady-Luc™ Reporter Assay Kit provides a highly sensitive assay for the quan-titation of firefly luciferase expression in mammalian cells. 384-well microplate for use in time-resolved fluorescence, luminescence, Alpha, and radiometric assays. When reading optical density at wavelengths below 340 nm, special UVtransparent, disposableFor SpectraMax ABS Plus reader, r 2 = 0. The SpectraMax® Gemini™ EM Microplate Spectrofluorometer from Molecular Devices® provides a flexible environment. , FI 15 sec. ‘StimB’ is Stimulation Buffer, included in the IP-One Gq kit. Stand alone mode is not available for the VersaMax. The SpectraMax® and VersaMax™ require proper ventilation to keep their internal components cool. Other recommended products. Detection modalities include absorbance (UV-Vis Abs) and fluorescence intensity (FI) and have optical performance comparable to a top-of-the-line dedicated spectrofluorometer or. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. Products : General, Microplate Readers. In addition, users can define individual reagents and concentrations to be delivered to eachMolecular Devices Microplate Reader Spectramax 384 340PC. On LabX buyers can find a variety of SpectraMAX models for sale: 190, 384, 340 and the SpectraMAX M series. Enables data acquisition in endpoint, kinetic, and spectral scan modes at wavelengths across the UV-visible wavelength range, with the only temperature-independent method of pathlength correction. Colorimetric assays. Cross-talk < 0. Accurate quantitation TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate spectrophotometersproviderapidandsensitivemeasurementsofavarietyofanalytes acrossawiderangeofconcentrations. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. SpectraMax® ABS Plus microplate reader can run both cuvette-based and microplate reader applications on the same instrument. Shaker time 0 to 999 seconds Temperature range Ambient +4°C to 45°C General specifications Dimensions (in. By measuring optical pathlength, it eliminates the last major distinction between microplate readers and spectrophotometers. Select ‘Water Constant’ in the Instrument Settings dialog box (Figure 3). Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. 96 , 384 , and 1536 well microplates Note: Detection Cartridges and PC not included. A microplate reader that can detect two or more applications is considered a multi-mode plate reader. In addition, the SpectraMax iD5 The SpectraMax® iD3 Multi-Mode Microplate Reader is the cornerstone of a complete laboratory solution to help you expand the boundaries of your research capabilities. These robust readers have been placed in labs from Antarctica to the. 2. No accessories are needed and SoftMax® Pro Software. ¨The SpectraMax M2 is a dual-monochromator, multi-detection microplate reader with a dual-mode cuvette port and 96 or 384 microplate reading capability. Below is the list of Molecular Devices microplate readers and liquid handling instruments that are of out-of-production and are now considered obsolete. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Molecular Devices Spectramax 384 Plus Microplate Reader. Molecular Devices would like to introduce to you the SoftMax Pro 7, software designed to provide the simplicity, flexibility and power required for advanced. Catalog Number. Temperature range between 4°C above ambient to 45°C. SpectraMax® Plus 384 provides ultrafast, full spectral range. The excitation and the emission. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. 020 fmol 0. Applications. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Standard features include UV-visible absorbance in tunable 1,0 nm increments up to 4,0 nm, and fluorescence intensity with spectral scanning across the wavelength range in 1 nm increments and up to four wavelength pairs per protocol. Shaker time 0 to 999 seconds Temperature control Ambient. Qualify the absorbance performance of SpectraMax® iD3, iD5, i3, i3x, M2, M2e, M3, M4, M5, M5e, Plus 384, ABS, ABS Plus, and FlexStation 3 readers. Manufacturer: Molecular Devices Model: SpectraMax Plus 384 The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. Monochromator wavelength selection saves you the time and trouble of ever having to. The SpectraMax® M3 Microplate Reader is the standard for UV/visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. OurSpectraTest ABS1 User Guide - Molecular DevicesLearn how to use the SpectraTest ABS1 plate to validate the absorbance performance of your microplate reader. 5 cm x. Technical specifications Detection limit for ATP Glow 0200-7012 (LUM) Optimized Guaranteed* 96-well (200 µL) 1. SpectraMaxPlus384reads96-wellplates,384-wellplates,andcuvettes. SpectraMax iD5; SpectraMax Mini; SpectraMax Mini Install Guide; SpectraMax Mini Reader Plug-In Download Page (required for SoftMax Pro 7. Upon completion of a plate read, data are delivered to your computer in an Excel-compatible format. The Molecular Devices SpectraMAX absorbance microplate readers mimic a dual beam spectrophotometer with a patented multichannel optical design. Measurement of tannin, iron-reactive phenolics, anthocyanin and polymeric pigment in red wine is an important part of quality control in the wine industry. In this product video, see how the SpectraMax M5 quickly reads samples. SpectraMax i3x Multi-Mode Microplate Reader. Now you can run both standard spectrophotometer and microplate reader applications on the same instrument. 96 wells 384 wells Absorbance 0:30 1:40 Fluorescence intensity 0:25 1:25 Luminescence 0:30 1:15. Computer and software not available. Page 1The Molecular Devices SpectraMax M2 Microplate Reader is a multidetection microplate reader with dualmonochromators, dual-mode cuvette ports, and top-reading capability. Microplate Readers. Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax GEMINI EM. SpectraMax Microplate Readers. Meso Scale Discovery 1250 Sector Imager 2400. The optical performance is comparable to a top-of-the-line dedicatedDescription Microplates The SpectraMax Multi-Mode Microplate Reader can accommodate SBS- standard 6-well to 384-well microplates and strip wells. 96- or 384-well microplate compatibility. Key features 4 wells: 76 seconds Luminescence Specifications Dynamic Range < 6 decades Sensitivity 10 amol ATP General Specifications. SpectraDrop Micro-Volume Refills, 24-Well Bottom Slides. Molecular Devices SpectraMax 384 Plus Microplate Reader Specifications. ELISAs/EIAs. SpectraMax iD3 reader with touchscreen and inserted USB flash drive. Figure 1. to View Figures. Learn how SpectraMax Plus 384 Microplate Reader & SoftMax Pro Software used for Phenolic compounds measurement in red wines which efficiently collect and analyze the data for this assay. The plate reader optics are tunable for absorbance, fluorescence intensity, fluorescence polarization, and time. Corning® EcoChoice™ products are produced, packaged, and/or distributed in an environmentally friendly manner following United States Government Federal Trade Commission (FTC) Guidelines Learn More. The PathCheck sensor can extend the instrument linearity by a factor of three or more. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. 0112-0115J 9 Chapter1:Introduction TheSpectraMax®M3Multi-ModeMicroplateReader,SpectraMax®M4Multi-ModeMicroplate Reader,SpectraMax®M5Multi-ModeMicroplateReader,andSpectraMax®M5eMulti-ModeNote: for SpectraMax microplate readers without a cuvette port, the water constant is automatically used in PathCheck calculations, and no Water Constant option appears in the Instrument Settings. With three modes of detection for full spectrum absorbance, fluorescence and luminescence, It is user upgradeable from 2 to 3 modes. The SpectraMax reader’s optical system mimics a dual-beam spectrophotometer. 2. SpectraMax® Absorbance Microplate Readers can run both cuvette-based and microplate reader applications on the same instrument. 0 nm increments. Wavelength(s): 230 to 750 nm (depending on model) Features: Shaking, Temperature Control. Multimode Reader Comparison Chart. Time Resolved Fluorescence: Solid white plates for top reads and white plates with clear bottoms for bottom reads. PathCheck sensor corrects optical pathlength & pipetting variation. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Also refer to this Multimode Reader Comparison Chart. Eight different automated tests are provided: • Absorbance accuracy (linearity) • Precision (reproducibility) • Stray light • Wavelength accuracy • Wavelength repeatabilityThe SpectraMax® ABS Plus Microplate Reader can run both cuvette-based and microplate reader applications on the same instrument. Microplate Readers include the M3, M4,. Users can password-protect data, choose from nine different curve-fitting routines and use default data reduction, or set up custom formulas for analysis. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Use any standard cuvette, 12 x 75 mm testThe SpectraMax Mini Multi-Mode Microplate Reader is a budget friendly solution. microplates or in a cuvette at a. spectramax i3 multi-mode platform, spectramax i3, spectramax i3 system, scanlater western blot system, spectramax minimax imaging cytometer, softmax pro software, metamorph software, spectramax i3 platform. 3) This warranty covers the SPECTRAmax. Check Details. Detection modalities are shown in Table 1-1. We have a great online selection at the lowest prices with Fast & Free shipping on many items!384-well (75 µL) 0. The SpectraMax M4 Microplate Reader is the standard for UV/visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes, 96 and 384-well microplates. The SpectraMax Plus 384 reader is equipped with an innovation patented by Molecular Devices, the PathCheck® sensor, which measures the depth of a sample in a microplate by optical path length. . Fluorescent detection is achieved from the top, through the entire depth of sample in the microplate well. When you do a read at wavelengths below 340 nm, you must use special UV-transparent, disposable or quartz plates to allow transmission of the deep UV spectra. Community forums for Molecular Devices - SpectraMax Plus. Also see:. Slide the tip into the nozzle, the slots are labeled 1 and 2 for injector 1 and injector 2. The optical system of SpectraMax Plus384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for absorbance detection in the UV-visible wavelength range (190 nm - 1000 nm). SoftMax Pro Software, the industry-leading microplate reader software for the SpectraMax Plus 384 system, allows complete customization of data collection and analysis. 5 pg/µL to 200 ng/µL. Clearance . Check the optical alignment, you will have to disassemble and remove optical cover. The SpectraMax 340PC384 system has a monochromator instead of interference filters. In case of a cuvette, the optical path is horizontal, hence. 4% in white 96- and 384-well microplates Sensitivity (ATP-Glow) Optimized 96 wells 3 pM 384 wells 6 pM. . By utilizing the optimized instrument settings suggested within this Application Note, Z' values > 0. used. Version7. Molecular Devices, LLC. SpectraMax Spectrophotometers for UV-Vis Absorbance Detection. With the QuickSync client installed on your computer, your SpectraMax iD3 reader can push data to any computer within the same network. SpectraMax®Plus384 SpectraMax®190 SpectraMax®340PC384. 100 fmol 1536-well (8 µL) 0. A & K Biosource are the pros on this, but these plate readers are quite expensive to repair/calibrate. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. spr SpectraMax iD5 SpectraTest ABS2 v1. Fluorescence filters included in 1nm range. Create custom fluorescence assays without having to purchase expensive filter sets. The SpectraMax Plus 384 Microplate Reader gives users the convenience of both standard spectrophotometer and microplate reader applications on the same instrument. Place the microplate on or remove it from the microplate drawer. Molecular Devices’ SpectraMax® Plus 384 Microplate Reader provides fast and reliable full spectral range detection for cuvettes, 96-well and 384-well microplates. 030 fmol Fluorescence Polarization (FP). . Read up to 6 wavelengths in endpoint or kinetic mode for 96- and 384-well plates, and perform spectral scans to determine. Page 19: Plate Adapter SpectraMax M2 and M2e Microplate Reader User Guide Plate Adapter Before you read standard 96-well or 384-well plates from the top, you must insert the plate adapter in the plate drawer. SpectraMax Paradigm Microplate Reader General specifications User-upgradeable Multi-Mode Detection Platform Technical specifications Optimized Guaranteed* Fluorescence Intensity (FI) (Fluorescein) 96-well (200 µL) 0. TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate spectrophotometersproviderapidandsensitivemeasurementsofavarietyofanalytes. 96 / 384 Head: Fixed Pin Tool - 384 Head: Grippable Pin Tool - 96 / 384 Head: Magnetic Pin Tool - 96 / 384 / 1536 Head: LUMINESCENCE MICROPLATE. Every step is optimized for data acquired from a Molecular Devices microplate reader or data imported from. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Review date: 12 Jun 2017 | SpectraMax Plus 384 Microplate Reader Get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. 8.